Protein Info for Psest_4327 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 161 to 189 (29 residues), see Phobius details amino acids 201 to 228 (28 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 353 to 378 (26 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 427 to 450 (24 residues), see Phobius details amino acids 469 to 490 (22 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 26 to 527 (502 residues), 697.2 bits, see alignment E=6.1e-214 PF00115: COX1" amino acids 34 to 477 (444 residues), 540.1 bits, see alignment E=2e-166

Best Hits

Swiss-Prot: 58% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 94% identity to pmk:MDS_0159)

MetaCyc: 93% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS09 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Psest_4327 cytochrome c oxidase, subunit I (Pseudomonas stutzeri RCH2)
MSAVIDDHGHAGHDHHHGPAKGLSRWLLTTNHKDIGSMYLWFSFCAFLLGGSMAMVIRAE
LFQPGLQIVQPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLMIGAPDMALPRMNNFS
FWLLPAAFGLLVSTLFMEGGGPNFGWTFYAPLSTTYAPESVTFFIFAIHLMGISSIMGAI
NVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGVVTMMLMDIHFGTSFFSA
AGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFSRKPLFGYTSMVYATGAIAFL
SFIVWAHHMFTVGIPLTGELFFMYATMLIAVPTGVKVFNWVSTMWRGSLTFEAPMLFAVA
FVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVPGAIFGIFASAYYWLPKWTGH
MYDETLAKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIPDYNMMFANFNMVSSVGAFMFGA
TQLLFLFIVIKCIRGGVPARAKPWDGAEGLEWSVPSPAPYHTFQTPPDMSDVHEHRKGTG
GELTP