Protein Info for Psest_4323 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 326 (314 residues), 74.6 bits, see alignment E=3.8e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_4158)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSL4 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psest_4323 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MHPTGSFHARENNFDFLRFFAAALVLFAHSYPLVGRREDEPLTLLTGYEKGGSIAVGVFF
VMSGYLIASSWLASSSPKSFLIKRALRIFPALIVAVLLSAFVIGPLVTQFDLGRYLAADG
TWTYLQNILLVTRYELPGVFTGNLYPDVVNGSLWTLPLEVLMYIGVMILGLTGFLKRRLI
FLPIAVLAFGHFWLLGKLGIESYFIKNIFKLGLLYYSGSALFLYRDDIPWRGWIAALLFA
ALVATFRTDIGPLVYFIALPYLVLYLAYAPLPLISRFGKYGDFSYGLYIYAFPFQQLTVY
LFGPQVGVLGLTLIAFAPTLILAALSWHLIEAPAMKLKRLFASPPQPGRATPKVEG