Protein Info for Psest_0429 in Pseudomonas stutzeri RCH2

Annotation: phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 1 to 247 (247 residues), 288.7 bits, see alignment E=2e-90 PF12974: Phosphonate-bd" amino acids 34 to 270 (237 residues), 261.2 bits, see alignment E=4.7e-82

Best Hits

Swiss-Prot: 99% identical to PTXB_PSEST: Probable phosphite transport system-binding protein PtxB (ptxB) from Pseudomonas stutzeri

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 99% identity to tgr:Tgr7_0913)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH04 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psest_0429 phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein (Pseudomonas stutzeri RCH2)
MKRLSALLLTCLLSAVSSLSALAADADPDVLKVALLPDENASELIKRNQPLKDYLEEHLD
KKVQLIVTTDYSSMIEAMRFGRIDLAYFGPLSYVMAKSKSDIEPFAAMVIDGKPTYRSVI
IANVASGVNEYADLKGKKMAYGDRASTSSHLIPKAVLLETAGLTGGQDYEQHFVGTHDAV
AVNVANGNADAGGLSEVIFNHAVERGLIDPSKVKVLGYSGEYPQYPWAMRSNLSPELKTK
VRDVFVGIDDPEVLRNFKAEAFAPITDADYDVIRNMGSLLGLDFATM