Protein Info for HP15_p42g2 in Marinobacter adhaerens HP15

Annotation: single strand DNA binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 PF00436: SSB" amino acids 3 to 98 (96 residues), 75.6 bits, see alignment E=1.5e-25 TIGR00621: single-stranded DNA-binding protein" amino acids 4 to 109 (106 residues), 86.8 bits, see alignment E=1e-28

Best Hits

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 69% identity to bam:Bamb_6592)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRR2 at UniProt or InterPro

Protein Sequence (111 amino acids)

>HP15_p42g2 single strand DNA binding protein (Marinobacter adhaerens HP15)
MFQFIGNLTRDTELHNSQGGSSRAIFDIAVNSTWGKGADKKEKTDFFRIKSFGAIADNAG
RYLGKGSKVFVQGRIENTRFEKDGKTEFGTDFIVEKIDYLDTKAPEGQQQG