Protein Info for Psest_4302 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13428: TPR_14" amino acids 52 to 90 (39 residues), 23.6 bits, see alignment 2.2e-08 PF14559: TPR_19" amino acids 64 to 127 (64 residues), 39.1 bits, see alignment E=3.1e-13 PF13432: TPR_16" amino acids 64 to 118 (55 residues), 33.7 bits, see alignment 1.6e-11 PF19413: YaiO" amino acids 153 to 321 (169 residues), 53.5 bits, see alignment E=1.2e-17 TIGR04390: outer membrane protein, YaiO family" amino acids 154 to 378 (225 residues), 140.5 bits, see alignment E=4.1e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRY1 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psest_4302 hypothetical protein (Pseudomonas stutzeri RCH2)
MKRALLLLALAMPCTTAFADTATAEGQVQAQQLDAAEATLRMHLAQHPGDADAQFLLARV
LSWQGRPQQALPIYQRLLSQQPDNADYLLGEGQALLWAGRPQRALASLERAARIAPDYAE
VQQVIQQARAALTVPTTATAPVPVTAAATKRRHELEISARQDWLDSGFDNWRSQRLDYTS
TRPESLGWYGALLREQRFGEWDEGVEAGAVIPLDDNWTLQSEVGYQPSPYFLPEWHADLR
LQRRLPDGYLGAVSVRRTEYETTRVDRLALSAERYWNAWRAGYTLNVTDVANAGTPIGHD
LALDYYYRGLSYAGLRLTVGEEEAVEEQQLITSDVRAISLQGRHWFDNRWALSWEIGHHQ
QGSYYDRQWLQLGLRHAF