Protein Info for Psest_0426 in Pseudomonas stutzeri RCH2

Annotation: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF13276: HTH_21" amino acids 33 to 89 (57 residues), 63.8 bits, see alignment E=2.7e-21 PF00665: rve" amino acids 114 to 212 (99 residues), 105.9 bits, see alignment E=2.5e-34 PF13683: rve_3" amino acids 205 to 267 (63 residues), 33.4 bits, see alignment E=6e-12 PF13333: rve_2" amino acids 219 to 273 (55 residues), 51.4 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 44% identical to INSF4_ECOLI: Transposase InsF for insertion sequence IS3D (insF4) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to psa:PST_2315)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIB1 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Psest_0426 Transposase and inactivated derivatives (Pseudomonas stutzeri RCH2)
MEYPVRRLCQTLQVHPSGYYAWLAEPKSAREKEDQRLLGLIKHAWLESGGVYGYRKIHDD
LRELGESCGRHRVARLMRVEGLRSQTGYRRRPGYYGGKPTVASPNRLERQFKVSEPNKVW
VTDITYIRTYEGWLYLAVVLDLFSRQVIGWSMKPRMCSDLAIDALLMAVWRRKPRQEVMI
HSDQGSQFSSSDWQSFLKANNLISSMSRRGNCHDNAVAESFFQLLKRERIRRKTYGTREE
ARSDVFDYIEMVYNPKRRHSSAMQLSPVEFEKRYFQSLESV