Protein Info for Psest_4283 in Pseudomonas stutzeri RCH2

Annotation: Spermidine/putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13416: SBP_bac_8" amino acids 39 to 323 (285 residues), 94.9 bits, see alignment E=1.2e-30 PF01547: SBP_bac_1" amino acids 40 to 295 (256 residues), 65 bits, see alignment E=1.8e-21 PF13343: SBP_bac_6" amino acids 73 to 311 (239 residues), 59.6 bits, see alignment E=5.2e-20

Best Hits

Swiss-Prot: 71% identical to SPUE_PSEAE: Spermidine-binding periplasmic protein SpuE (spuE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 96% identity to psa:PST_0068)

MetaCyc: 57% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSI1 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psest_4283 Spermidine/putrescine-binding periplasmic protein (Pseudomonas stutzeri RCH2)
MRSTLKSLLVAAAMTGAATAQAASVHIYNWSDYIGETTLEEFEKETGIKPVYDVFDSNET
LEGKLLAGRSGYDVVVPSNHFLGKQIRAGAFQALDKSKLPNWEHLDPALLKQLQKNDPGN
AHAAPYLWGTNGIGYNVEKVKAALGVDEIDSWSVIFEPENAAKLASCGIAFLDSADEMIP
AMLNYLGLDPNSENAADYQKAEEKLLAVRPHVRYFHSSKYISDLANGNICVAAGFSGDVF
QAAARAEEAGKGIEIAYAIPAEGANLWFDMLAIPADASNVEEAHAFINYLLRPEVIAAVS
DYVGYANPNLKAGELMDQEVREDASVYPPQEVLDRLYVSAELPPKIQRLMTRTWTKVKSG
K