Protein Info for Psest_4277 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 74 to 94 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 246 (162 residues), 51.4 bits, see alignment E=5.8e-18

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 82% identity to tmz:Tmz1t_1806)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRV3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psest_4277 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MSLLRSWLAGLPGYLWSGWGALASLFLLLAGWEAVASQYGALVLPTPLETFVRLLQLIDE
GAAWPELLATSRRALLGFTLSVVVGSVLGLAAGVSMTASMMARPLVTVLMGMPPIAWLVL
AMLWFGASDGTPVFTVFIASFPLVFVGALQGTRTLDNQLKDMALAFRLPRRMLLLDVYLP
HVVSYLFPAWITALAMAWKIVVMAELLATQDGVGAALAVSRSHLDTSATMAWITAVVGLL
LAVEYLLLEPIKREVERWREVSS