Protein Info for Psest_4273 in Pseudomonas stutzeri RCH2

Annotation: Lysophospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF12146: Hydrolase_4" amino acids 67 to 297 (231 residues), 100.7 bits, see alignment E=1.2e-32 PF12697: Abhydrolase_6" amino acids 72 to 295 (224 residues), 55 bits, see alignment E=2.8e-18 PF00561: Abhydrolase_1" amino acids 72 to 156 (85 residues), 39 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_0072)

Predicted SEED Role

"Lysophospholipase (EC 3.1.1.5)" in subsystem Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSH1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Psest_4273 Lysophospholipase (Pseudomonas stutzeri RCH2)
MPSRIQPDRLRNSLPALADAADISAETLHYQAYYGLDMPHRRNVQRRLGRFRVHDYDVVA
QAWWPEQPHASLLILHGYYDHMGLYRHVVDWGLEMGFAVLACDLPGHGLSSGPRASINEF
DEYQAVLSGLFEQARQLDLPRPWHLLGQSTGGAIALDHLLHQADNPDLGRTILLAPLIRP
RAWLRSRISYELLRRFVQQIPRTFSENSGDPSFLEFVQSQDPLQPDILPTAWVGALSRWI
PRIEGAAGSTHSPLIIQGEADMTVDWQYNLPILERKFAGAEILRLPEARHHLVNEREELR
RAYFDFLRERLK