Protein Info for PGA1_c04310 in Phaeobacter inhibens DSM 17395

Annotation: Protein of unknown function (DUF1045).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF06299: DUF1045" amino acids 61 to 217 (157 residues), 167.2 bits, see alignment E=4.4e-53

Best Hits

KEGG orthology group: None (inferred from 60% identity to sit:TM1040_3696)

Predicted SEED Role

"Protein RcsF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWH0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PGA1_c04310 Protein of unknown function (DUF1045). (Phaeobacter inhibens DSM 17395)
MTVTRYAIYYVPPAQAEWSRFASSWLGWDVHEGAPLDHPTGTGLDVAAITDVPRKYGLHA
TIKPPFRLAEGTTSDALAERFAQFAAAAKPVALDGLSLTRLGRFLALCPSGDQLGLNRLA
FHCVRDLDEFRARPTLDELEKRRAGGLSSAQEQALVTWGYPYVGDSFRFHITLSGKRPKA
ELPAIEAVLRDRLVPQLPIPFVIGDLALVGEDSDGRFHMLHRHALSG