Protein Info for Psest_4270 in Pseudomonas stutzeri RCH2

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 357 to 385 (29 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 428.5 bits, see alignment E=1.3e-132 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 493.6 bits, see alignment E=2e-152

Best Hits

Swiss-Prot: 86% identical to DCTM_PSEAE: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 98% identity to psa:PST_0076)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTW3 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Psest_4270 TRAP transporter, DctM subunit (Pseudomonas stutzeri RCH2)
MTILFLFAALFVLMFIGVPVAVSLGLAGSLTIMIFSQDSVRSLAIKLFETSEHYTLLAIP
FFLLAGAFMTTGGVARRLIDFANACVGHIRGGLAIGAVLACMLFAALSGSSPATVAAVGS
IAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSVVMVVYAAATETSVGKLFMAGVVPGIL
LGGALMIAIYIIAVKKNLPALPRASFREWLSAARKAIWGLLLMVIILGGIYSGMFTPTEA
AAVAAVYSAFVALFVYKDISLRDCPKVLLESGKLSIMLMFIIANAMLFAHVLTTEQIPQA
ITAWVIEAGLQPWMFLLVVNIVLLIAGAFMEPSAIILILAPILFPIAIQLGIDPIHLGII
MVVNMEIGLITPPVGLNLFVASAVTGMPVTQVIRAVLPWLALMLSFLVIITYVPSISLAL
PNMLGM