Protein Info for HP15_4134 in Marinobacter adhaerens HP15

Annotation: ABC-type polar amino acid transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00005: ABC_tran" amino acids 39 to 170 (132 residues), 77.9 bits, see alignment E=1.2e-25 PF13304: AAA_21" amino acids 135 to 201 (67 residues), 37.5 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: K06857, putative tungstate transport system ATP-binding protein (inferred from 65% identity to mag:amb3045)

Predicted SEED Role

"ABC-type tungstate transport system, ATP-binding protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMJ0 at UniProt or InterPro

Protein Sequence (247 amino acids)

>HP15_4134 ABC-type polar amino acid transport system, ATPase component (Marinobacter adhaerens HP15)
MTSLNVPLNNSIELSAPPSLRFENVEFNPFGHRLFGPCSFTLDGPGPTLVMGPNGAGKSL
MLRLAHGLLTPTEGAVSWSGASAPRQAMVFQTPILLRRSALANLRHALAVNNVPRKLRTE
LALEALARFGLSSCADTPARVLSGGEKQRLALARAWSLSPAVLFLDEPTSALDPAAIKAV
ETAVKEFHDQGTRIVMTTHDLHQARRLAGDVLFLSGGQVQEHTPADVFFETPVSRQAQAF
ISGELVA