Protein Info for HP15_4128 in Marinobacter adhaerens HP15

Annotation: molybdopterin biosynthesis protein MoeA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF03453: MoeA_N" amino acids 19 to 180 (162 residues), 141.1 bits, see alignment E=3.8e-45 TIGR00177: molybdenum cofactor synthesis domain" amino acids 189 to 322 (134 residues), 93.4 bits, see alignment E=6.5e-31 PF00994: MoCF_biosynth" amino acids 193 to 328 (136 residues), 101.5 bits, see alignment E=5.3e-33 PF03454: MoeA_C" amino acids 351 to 409 (59 residues), 44.9 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 37% identical to MOEA_HAEIN: Molybdopterin molybdenumtransferase (moeA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 58% identity to sil:SPO0310)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMI4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>HP15_4128 molybdopterin biosynthesis protein MoeA-like protein (Marinobacter adhaerens HP15)
MKPLRNDCFALPPGVNWTPVEEALERLRSRLHPVVETEHAVPLSRVNGRILASDVYAPRA
HPPSNNSAVDGYALAGPVTDVPCTLPLVDGRSAAGEPFKGQVPAGHAIRILTGAVIPSGT
DTVVLEEDCEVRDGQLYLNGTLKAGANARKAGEDIQAQDRILIAGTRLTPTQISVLASVG
VESVDVYQKLRVGVLSTGDEVKPVGATVTDWQIYDANRPMLSALVSQLGYELVDLGHALD
RADEVKSALETGAQECDLILTSGGVSAGDEDHVSKTLKAHGDISNWRIAIKPGRPLALAM
FQGTPVVGLPGNPVAAWVCALRFGAPAMALLAGGEWFEPQAYVMPANFSKNKKPGRSEML
RARVRDGQVEVFGSEGSGRVTGLAWSEGLVELDESAQQIEPGTPVRFIPYGSFGL