Protein Info for HP15_4124 in Marinobacter adhaerens HP15

Annotation: protein containing 4Fe-4S ferredoxin, iron-sulfur binding, subgroup domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF12838: Fer4_7" amino acids 268 to 309 (42 residues), 32.7 bits, see alignment 4.2e-11 PF12837: Fer4_6" amino acids 287 to 309 (23 residues), 25.1 bits, see alignment (E = 6.2e-09) amino acids 486 to 508 (23 residues), 25 bits, see alignment (E = 6.8e-09) PF13237: Fer4_10" amino acids 287 to 324 (38 residues), 25 bits, see alignment 7.6e-09 amino acids 486 to 535 (50 residues), 25.7 bits, see alignment 4.7e-09 PF00037: Fer4" amino acids 288 to 310 (23 residues), 25.6 bits, see alignment (E = 4.1e-09) amino acids 486 to 508 (23 residues), 30.3 bits, see alignment (E = 1.3e-10) PF12800: Fer4_4" amino acids 293 to 307 (15 residues), 13 bits, see alignment (E = 5.7e-05) amino acids 491 to 506 (16 residues), 14.3 bits, see alignment (E = 2.2e-05) amino acids 522 to 536 (15 residues), 12.2 bits, see alignment (E = 0.00011) PF13187: Fer4_9" amino acids 492 to 539 (48 residues), 31.8 bits, see alignment 6e-11

Best Hits

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PMI0 at UniProt or InterPro

Protein Sequence (637 amino acids)

>HP15_4124 protein containing 4Fe-4S ferredoxin, iron-sulfur binding, subgroup domains (Marinobacter adhaerens HP15)
MRKAAGAEQAIAVDQLCGKELSVAAEHLGASNDVLIACGQQAALFERLAEDVHAEIQHAA
PLQSIDIRDRAGWSAPDAKPERLHAKQAALIAAAQLPPPMAPAKTIQSNGVCCIVGPTEK
AIRMAGLVQDELGVTCIVNDAGPIQLPSAAYDVAKGQLTGAYGALGNFKLEFAHLQPLHP
AGRGELGYEAAKPTARSECDVFIDLRGGAPAFPSHEKRNGYFWADPEKSGELERIALTAR
EMVGEFEKTVYFRLEESLCAHSRANKPGCTRCLDVCPTEAIFSFGDHIQIDSDICAGCGS
CAAVCPTSAVTMNETPFEAITKAVEVMAKVYREHTHESPRLVFHTLEAGTEAIANLARYD
NGLADDLIPMGLEHVDRIGHAEIMAAFGAGYAEVLILADNELDRRAVTAEVELAQAMLKG
THNSPSRIRVISAIELCDAGDNAGRVSDPVLLVGGRRDITRVTVAAMSEKIEEPIPLPKG
APYGAIEIDSDKCTLCLACVSLCPTGALGDHPDRPEVQFTENACVQCGICESTCPETAIT
LKPQLDVSKAALSARALHGEEPFECIKCGTPFGVASTINRIVEKLENQHWMYKNSDNVQL
IKMCDDCRVKAQFHGSTAPMAGGERPRVRTSDDYLDS