Protein Info for Psest_0419 in Pseudomonas stutzeri RCH2

Updated annotation (from data): Acyl-CoA dehydrogenase (EC 1.3.8.7)
Rationale: Specifically important for: L-tyrosine disodium salt; Sodium butyrate; Tween 20. tween 20 hydrolyzes to a mix of C12, C14, and C16 fatty acids; this is probably part of beta oxidation (SEED_correct)
Original annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 125 to 140 (16 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 38 to 158 (121 residues), 44.1 bits, see alignment E=6e-15 PF02770: Acyl-CoA_dh_M" amino acids 163 to 272 (110 residues), 50 bits, see alignment E=7e-17 PF00441: Acyl-CoA_dh_1" amino acids 283 to 451 (169 residues), 65.5 bits, see alignment E=1.5e-21 PF22924: ACOX_C_alpha1" amino acids 293 to 447 (155 residues), 28.4 bits, see alignment E=3.3e-10 PF12806: Acyl-CoA_dh_C" amino acids 468 to 586 (119 residues), 134.1 bits, see alignment E=7.8e-43

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_3858)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI16 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Psest_0419 Acyl-CoA dehydrogenase (EC 1.3.8.7) (Pseudomonas stutzeri RCH2)
MADYQAPLRDMRFVLNEVFDAPKLWQALPALAEVVDAETADAILEEAGKITANSIAPLNR
SGDEEGCRWDAGAVSTPAGYREAYQLYAKGGWVGVGGDPAFGGMGMPKVISAQVEEMMNS
ASLAFGLYPMLTSGACLSIYAHASEELKQKYLPNMYAGVWSGSMCLTEPHAGTDLGIIRT
KAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKLPDAPAGSRGISLFLVPKVMVNE
DGSLGERNSLSCGSIEHKMGIQASATCVMNFDGAVGWMVGEPNKGLAAMFTMMNYERLGV
GIQGLATGERSYQSAIEYARDRIQSRAPTGPVAQDKAADPIIVHPDVRRMLLTMKALNEG
GRAFSSYVALQLDIAKFSDDDEARQRAEAQVALLTPVAKAFLTDMGLETTVHGQQVFGGH
GFIREWGQEQLVRDCRITQIYEGTNGIQALDLVGRKIVGSGGTMYQAFVDEIRAFIADAG
PELTEFAEPLKAAMDNLDELTAWVIDQAKANPNEIGAASVEYLHVFGYTAYAYMWARMAA
VAVAKREEGDFYQSKLGTARFYFARLLPRIHSLSASVKAGSESLYLLDAAQF