Protein Info for Psest_4242 in Pseudomonas stutzeri RCH2

Annotation: type VI secretion system FHA domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR03354: type VI secretion system FHA domain protein" amino acids 3 to 387 (385 residues), 377.7 bits, see alignment E=7.1e-117 PF00498: FHA" amino acids 29 to 97 (69 residues), 45 bits, see alignment E=1.2e-15 PF20232: T6SS_FHA_C" amino acids 211 to 385 (175 residues), 161 bits, see alignment E=2.8e-51

Best Hits

KEGG orthology group: K11894, type VI secretion system protein ImpI (inferred from 79% identity to pmy:Pmen_0100)

Predicted SEED Role

"Uncharacterized protein ImpI/VasC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRR9 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Psest_4242 type VI secretion system FHA domain protein (Pseudomonas stutzeri RCH2)
MELVFDMVGAQQFVPGLLTTKTFKQAGGVIGRAEGCDWVIPDRKRVLSGRHAVISYRDGG
FFLTDTSSNGIQLKDSGASLVKGQPQRIEHGSVYCLGDFEIRARLIQDPALFEGDIGRPQ
PAGTIIPDDAFLDLDPLVAMDQQERIYAEVDDLDLTLVAPQRQAQQRDYARIDTESLPLP
ELVMPQVATEPKREPEPERLPPGFWQRFGDALGVDLKDMDEDQRQALALNAARLLKQSIG
GLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSADTGEAMSALLRGGKPGQLTAEQAVG
RAFRDLQAHQVALLAASRAAVQAMFEQLAPEQLALRFEREGRKPLLATAGSRWRAYRRLH
HSLGQDADWSERLFARDFAKTYEEQVRLIATLDSTHQG