Protein Info for Psest_4238 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome c556

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01322: Cytochrom_C_2" amino acids 28 to 152 (125 residues), 121.2 bits, see alignment E=2.6e-39

Best Hits

Swiss-Prot: 57% identical to CYCP_ALLVD: Cytochrome c' (cycA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 98% identity to psa:PST_0097)

Predicted SEED Role

"cytochrome c, class II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPN0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Psest_4238 Cytochrome c556 (Pseudomonas stutzeri RCH2)
MKALMTGAVAAVLLASTAVQAQMKPEEMVETRQAGYQFMSWNMGKIKAQVIDGKEPYDQA
KVAAAANAIAAIANAGMGSLYSPDTTTEQLGKATRLKPEFFQNLGEAGQIGRNFTAAANQ
LAKVAAEGDQAAIKKAFGDVGGSCKSCHDKFRAD