Protein Info for Psest_4232 in Pseudomonas stutzeri RCH2

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 384 (364 residues), 164.3 bits, see alignment E=5.9e-52 PF00083: Sugar_tr" amino acids 57 to 208 (152 residues), 37.6 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_0102)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSD1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psest_4232 Sugar phosphate permease (Pseudomonas stutzeri RCH2)
MHNNNNGYPSQTRAWVTVAILMLAYVLSFVDRQILNLLVEPIRRDLDITDTHMSLLMGFS
FAVFYTICGVPIGRLADRKSRRGIIAIGVLVWSLMTALCGTARTFWQFLVFRIGVGVGEA
ALSPSAYSLIADSFPPKLRGTAMSVYSMGIYIGSGLAFLLGGLVVKFASAQGDVELPVLG
MVRPWQLIFLVLGAAGVLFTAVLLLIREPSRKGVGAGVEVPLSEVAGYIRQNRRTVLCHN
FGFACLAFAAYGSSAWIPTFFIRTYGWSASDVGVLYGSVVAVAGSIGIIAGGRLSDLLHR
RGYRDAPLRVGIISAALTLPLNLAYLAGTGELALALIALHVFTIAMPFGVGPAAIQEIMP
NSMRGQASAVYLFVITMVGLGIGPTAVALGTDFVFGDDNALRYSLLIVTGVALVGAMILL
GMGLKHYRGSLDRLQEWKPQGAAPVEAQANPA