Protein Info for Psest_4227 in Pseudomonas stutzeri RCH2

Annotation: ribosomal protein L28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 TIGR00009: ribosomal protein bL28" amino acids 1 to 58 (58 residues), 99.1 bits, see alignment E=7.7e-33 PF00830: Ribosomal_L28" amino acids 3 to 62 (60 residues), 102 bits, see alignment E=7e-34

Best Hits

Swiss-Prot: 95% identical to RL28_PSEPW: 50S ribosomal protein L28 (rpmB) from Pseudomonas putida (strain W619)

KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 94% identity to pmk:MDS_4704)

MetaCyc: 82% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L28p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSC6 at UniProt or InterPro

Protein Sequence (78 amino acids)

>Psest_4227 ribosomal protein L28 (Pseudomonas stutzeri RCH2)
MSRVCQVTGKGPVTGNNVSHANNKTRRRFLPNLQHHRFWVESENRFVRLRLSAKGMRIID
KRGIDVVLSELRARGEKV