Protein Info for HP15_4093 in Marinobacter adhaerens HP15

Annotation: membrane protein containing diguanylate cyclase, predicted domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 226 to 386 (161 residues), 153.5 bits, see alignment E=2.2e-49 PF00990: GGDEF" amino acids 228 to 384 (157 residues), 148.2 bits, see alignment E=9.6e-48

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLS0 at UniProt or InterPro

Protein Sequence (396 amino acids)

>HP15_4093 membrane protein containing diguanylate cyclase, predicted domains (Marinobacter adhaerens HP15)
MDLNMHLPTLLVTSIMINLLIGGMLWAIYHLRHRERCFLLWALACLTFVAGTALAVVNEV
TEAPALMQFTVHLALGGSPLLLLAGIHALMQLPMAGTRGASRFLYGASLVYLFGLVVSTG
WDPVAARFLTALFSALVFSLAIYRLASIERKPRLPLRILQTLFGIHGTLMMAQVLVIAVS
VTGSAPLDLHGLLKLILVNHLLLVSATAMALPLLAFTRAEQALVALAERDGLTQLFNRRA
FYREGNLAFEKAREDGSLITVLMIDLDHFKQINDRWGHATGDEVLRIVANLMKAELRDDD
IIGRVGGEEFAAVLRNNNREAIEAVTGRLLQRIVEAGRGVDGVPVHLSASIGGASLALEH
AAFSDVMASADRALYQAKHNGRNRAEFVTASAAAKP