Protein Info for HP15_4078 in Marinobacter adhaerens HP15

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00255: GSHPx" amino acids 50 to 144 (95 residues), 75 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 75% identity to maq:Maqu_0359)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLQ5 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HP15_4078 glutathione peroxidase (Marinobacter adhaerens HP15)
MNRESGSMKQVKRGLIITALILGLSGAQVVMADSCPAFLDHEQRKLHSTDTVNLCDLAAG
KPMLVVNTASRCGYTGQFEGLEALHKQYSEKGLVVVGFASDDFRQEADSEAEAATVCFKN
FGVTFTMIAPGAVTGAEANPVFRAINEQSQPPRWNFTKYVIDRSGTVVDSFPSRVRPQDP
ELIDAVESVL