Protein Info for Psest_4206 in Pseudomonas stutzeri RCH2

Annotation: Putative NADPH-quinone reductase (modulator of drug activity B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF02525: Flavodoxin_2" amino acids 2 to 188 (187 residues), 119.3 bits, see alignment E=9.1e-39

Best Hits

Swiss-Prot: 61% identical to MDAB_ECO57: Modulator of drug activity B (mdaB) from Escherichia coli O157:H7

KEGG orthology group: K03923, modulator of drug activity B (inferred from 96% identity to psa:PST_0121)

MetaCyc: 61% identical to NADPH:quinone oxidoreductase MdaB (Escherichia coli K-12 substr. MG1655)
RXN0-271 [EC: 1.6.5.10]

Predicted SEED Role

"NAD(P)H dehydrogenase (quinone)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRN9 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Psest_4206 Putative NADPH-quinone reductase (modulator of drug activity B) (Pseudomonas stutzeri RCH2)
MKKILLLNGGKAFAHSAGQYNATLHQAANETLTAAGFEVRTTEIDAGYDVQQEVEKILWA
DALIYQMPGWWMGAPWTVKKYLDEVFTAGHGSLYANDGRTRSDASQKYGSGGLLQGKRYM
ISATWNAPQQAFDDPSDFFAGKGVDAVYLPFHKAHEFLGLQGLPTFLCVDVMKRPRIEAD
VERYRRHLGEVFGFNV