Protein Info for Psest_4205 in Pseudomonas stutzeri RCH2

Annotation: NAD/NADP transhydrogenase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details PF02233: PNTB" amino acids 7 to 475 (469 residues), 625.3 bits, see alignment E=3.5e-192

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 98% identity to psa:PST_0122)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTG1 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Psest_4205 NAD/NADP transhydrogenase beta subunit (Pseudomonas stutzeri RCH2)
MSMNLITLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLAVLTTVGLIFKLGSELA
TAGIGYVIVGLLIGGSVGTVMAKRVEMTKMPELVAFMHSMIGLAAVFIAIAAVVEPQSLG
IVEQIGYAIPVGNRLELFLGAAIGAITFSGSVIAFGKLSGKYKFRLFQGAPVVFKGQHMV
NLAVGLAIVGLGLVYTFTGNLTAFAIVVALAFVIGVLIIIPIGGADMPVVVSMLNSYSGW
AAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFFNVILGGFGADADAGGPAGA
QLERNVKSGSADDAAFLLTNADTVIIVPGYGLAVARAQHALMELAEKLTHMGVTVKYAIH
PVAGRMPGHMNVLLAEAEVPYEQVFEMDDINSEFGQADVVLVLGANDVVNPAAKTDPKSA
IAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYMDKTMMVFGDAKKVVEDMVKAVE