Protein Info for Psest_4201 in Pseudomonas stutzeri RCH2

Annotation: general secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 169 to 192 (24 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 285 to 298 (14 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 403 (400 residues), 517.2 bits, see alignment E=1.9e-159 PF00482: T2SSF" amino acids 71 to 193 (123 residues), 110.5 bits, see alignment E=2.8e-36 amino acids 273 to 395 (123 residues), 101.1 bits, see alignment E=2.2e-33

Best Hits

Swiss-Prot: 78% identical to GSPF_PSEAE: Type II secretion system protein F (xcpS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 98% identity to psa:PST_0126)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRN5 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Psest_4201 general secretion pathway protein F (Pseudomonas stutzeri RCH2)
MAAFEYLALDPRGREQKGLIEADSPRQARQLLREKQWAPLEVKQAKSKEDVSRGGFSFGR
GLSARDLALVTRQLATLVQAALPIEEALRAAAAQSTSAKIKSMLLAVRARVMEGHSLAAA
LREYPSAFPELYRATVAAGEHAGHLGLVLDQLADYTDQRQQSRQKIQLALLYPVILMVAS
LAIVVLLLGYVVPDVVKVFVNTGQELPALTRGLIATSDVVKNWGWLIVLGIIAGVLAMRA
ALRDPALRLRWHAFILRIPLIGRLSRATNTARFASTLAILTKSGVPLVEALSIAAAVIAN
LRIRERVVEAAQKVREGSSLTRALDATGEFPPMMLHMIASGEKSGELDQMLARTARNQEN
DLAAQVSLLVGLFEPFMLVFMGAVVLVIVLAILMPILSLNQLVG