Protein Info for HP15_4063 in Marinobacter adhaerens HP15

Annotation: spermidine/putrescine ABC transporter, permease protein PotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 192 to 221 (30 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 276 (196 residues), 38.3 bits, see alignment E=5.9e-14

Best Hits

Swiss-Prot: 53% identical to POTB_SALTS: Spermidine/putrescine transport system permease protein PotB (potB) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 90% identity to maq:Maqu_0342)

MetaCyc: 53% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLP0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>HP15_4063 spermidine/putrescine ABC transporter, permease protein PotB (Marinobacter adhaerens HP15)
MQQPFKNAVLILVWGWLLFLVLAPNLLVVGASVMTRDPVSFLSLPLNLDAYRQLFDPLYL
DVFLHSLYMAAMTTLVCLLIGYPFAWALSKVGKQRQLVLIFLLIVPFWTNSLVRTYALKL
ILATNGLLNSALMSIGLIDEPLQLLYTEGAVIIGLVYLLLPFMILPLYSVFEDLKQELLL
ASHDLGAGRLSTFVHVIVPLTLPGVLAGVMLVLLPAMGLFFVPDILGGSRNLLVGNVIKN
QFLDARNWPFGAAASIVLTVTMAFLMFAHRLSKRRIGEEGA