Protein Info for Psest_4194 in Pseudomonas stutzeri RCH2

Annotation: Type II secretory pathway, component PulM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details PF04612: T2SSM" amino acids 14 to 166 (153 residues), 156.8 bits, see alignment E=2.8e-50

Best Hits

Swiss-Prot: 44% identical to GSPM_PSEAE: Type II secretion system protein M (xcpZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02462, general secretion pathway protein M (inferred from 98% identity to psa:PST_0133)

Predicted SEED Role

"General secretion pathway protein M"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTP2 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Psest_4194 Type II secretory pathway, component PulM (Pseudomonas stutzeri RCH2)
MNLKQQLAVRLADSPLWQRWQRLAPRERTSLSLLGAFLLAVLFYLWLWLPAQRQAADARE
YYQAQRELHAYMEQNTELARQMERSNQVELAPEQLQGVITESAQQGNLSIESFDNGSDGS
LQVSLPGASYALLLRWFDALQGQGVSVTEVSLERAGEGLVNARVSFRAST