Protein Info for Psest_4193 in Pseudomonas stutzeri RCH2

Annotation: Predicted signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 253 to 273 (21 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details PF04073: tRNA_edit" amino acids 36 to 140 (105 residues), 41.6 bits, see alignment E=1.3e-14 PF08668: HDOD" amino acids 194 to 394 (201 residues), 162.8 bits, see alignment E=7.1e-52

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_0134)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPI7 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Psest_4193 Predicted signal transduction protein (Pseudomonas stutzeri RCH2)
MNTAVDTESCSELPLLITKLLKDLGVSYQIQRDRPNFPAAQRVQAVLLDDSIGAMLVLFP
QDHLLDLARLAELTGRELAAVKPERLARMLAKHELTRLPGLPPLTSSPCLYEEQLLQQPR
LLVESGQPGLLVEVAGGEFKRMLSKATAGSFAVPLNNIRPNLNRPNDDRAEITQAVQSFT
ARRIQKRLEETIEIPPLPHTAQKIIKLRVNPEATVDDITGVVETDPALAAQVISWAASPY
YAAPGRIRSVEDAIVRVLGFDLVINLALGLALGKTISLPNDKPQDATPYWQQAIYTAAVI
EGLTRAIPREQRPEPGLSYLAGLLHNFGYLVLAHVFPPHFSLICRHLEANPHLSHSHVEQ
HLLGITREQIGAWLMRLWGMPEELAAALRFQNDPSYDGEDAAYPNLVCLAVRMLRNRGIG
SGPDAEVPQELFDRLGITREKANDAVAKVLAAEAALRALAMQFNTPH