Protein Info for Psest_4191 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 69.3 bits, see alignment E=2.2e-23 PF03466: LysR_substrate" amino acids 87 to 293 (207 residues), 155.6 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 36% identical to OXYR_HAEIN: Hydrogen peroxide-inducible genes activator (oxyR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 98% identity to psa:PST_0136)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRM8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psest_4191 Transcriptional regulator (Pseudomonas stutzeri RCH2)
MTLTELRYIVTLAQEQHFGRAAERCHVSQPTLSVGVKKLEDELGVLIFERTKSAVRLTPV
GEGIVTQAQKVLEQAQSIRELAQVGKNQLAAPLKVGAIYTVGPYMFPHLIPQLHRVAPDM
PLYIEENFTHILRDKLRTGELDAIIVALPFQEADVLTKPLYDEPFYVLMPADHPWTAKET
IDAEMLNDKSLLLLGEGHCFRDQVLEACPTTRKGEAPSHTTVESSSLETIRHMVASGLGV
SILPLSAVESHHYSPGVLEIRPLTPPVPFRTVAIAWRASFPRPKAIEILADSIRLCSVGK
PTAAKS