Protein Info for HP15_4055 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF81

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 60 (27 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details PF01925: TauE" amino acids 11 to 229 (219 residues), 66.1 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 39% identity to hha:Hhal_1706)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLN2 at UniProt or InterPro

Protein Sequence (240 amino acids)

>HP15_4055 membrane protein containing DUF81 (Marinobacter adhaerens HP15)
MSLLQILLANLAILAGACLQGVAGYGIGTLAAPLLFLISPVLVPGPLILNATLLTVFMLI
RNRGALQVREVRFAIGGGVAGAVLAALTLLVISTKGFELTFGILILAGVALSVGGLKPAL
NARNSVLAGAASTYMGTITAVGGPPIALIYQNEKGPLVRANMSAFFLAASVLSLSGLLAS
GYLGTRELFLFAVTFPGVFLGFWLSGKLVHRMPFEGLRPVILGIAAIAGTAALIRGLISL