Protein Info for HP15_4049 in Marinobacter adhaerens HP15

Annotation: HD-GYP domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF11871: DUF3391" amino acids 23 to 172 (150 residues), 89.3 bits, see alignment E=4.9e-29 PF13487: HD_5" amino acids 196 to 357 (162 residues), 125.8 bits, see alignment E=2.4e-40 PF01966: HD" amino acids 203 to 325 (123 residues), 61.1 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 69% identity to maq:Maqu_0329)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLM6 at UniProt or InterPro

Protein Sequence (460 amino acids)

>HP15_4049 HD-GYP domain protein (Marinobacter adhaerens HP15)
MRPYDELQTARLIGMRYETVELEIDVSELRVGMHVVRLDRPWEDTDFLIQGFVVQRQEDI
DALQSQCRRVVIEGKVKNTEPDISQRKSRTSAKSRFSMFHGPTSEQEISNRPQEPIAETG
NSRSRQRITYINKVSVDREIRKASGHYAEAKSFADSIMSGLRVGRTLDLNKAREVVDNCV
DSILRNEDALLLLTKLKNKDKYTAEHSLNVSILSAAFGKKLGLLEEEIRSLGLAGLLHDI
GKAKVPVDLLQKPGPLTPEEHGIMQNHANWGRDMLMALPRVVHAAVDVAYNHHERLDGRG
YPRGLVDSQIPYFAKIVAIVDTYDAITSNRAYDRARSSREALEIIHRFRGIQFDPELARE
FVLLIGIYPPGAIVEMKSGEVAIVIGSNPKNRRKPKVVLVRDENKQRPAKYRLLDLQTEP
LNSVGEPFEIIKEVPDGTYGIVLQRFIDNGLTLELNDASV