Protein Info for HP15_4042 in Marinobacter adhaerens HP15

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF01618: MotA_ExbB" amino acids 107 to 190 (84 residues), 24 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to maq:Maqu_0323)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein, probably associated with flagella"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLL9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_4042 MotA/TolQ/ExbB proton channel family protein (Marinobacter adhaerens HP15)
MSNPKHTLFWMTLFLGVVVIVGALIHKPLISAFMANWVFNLLILGVLIIGIALTYRQVFV
LFPELKWIAQFRTGHAGLSVVQEPKLLKPLARQLGEDATKDRFTLSTLSLRTVLDGIHSR
MDEQREITRYFISLLVFLGLLGTFWGLLGTINSVGQVITGLDMSQEDFGKVFAELQEGLL
TPLEGMGTAFSSSLLGLGGSLILGFLDIQAGHAQNRFYDGLEEWLTGVTNLVDRIDDEKD
LS