Protein Info for HP15_4040 in Marinobacter adhaerens HP15

Annotation: ketopantoate reductase ApbA/PanE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02558: ApbA
  • amino acids 1 to 152 (152 residues), 106.6 bits, E=9.6e-35
• TIGR00745: 2-dehydropantoate 2-reductase
  • amino acids 1 to 304 (304 residues), 207.4 bits, E=1.5e-65
• PF08546: ApbA_C
  • amino acids 183 to 304 (122 residues), 102 bits, E=3e-33

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

See E4PLL7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HP15_4040 ketopantoate reductase ApbA/PanE (Marinobacter adhaerens HP15)
MGAGGIGGYYAARLLHAGHEVVLTARGAHLAALEEQGLTVQYGDEVWSFPVQSMDHSAVV
ARFRPDDFDVVLVTLKSTATEAMLAELGPWLYHGKVPVLSLQNGVDNEPALASLLGEHRV
LGGLAVRIGGHIVQPGVVQAEGPAQIVMGEWPMALGSDLRGQLLQQLQEDFEAAGIPTTV
SDNIRYELWRKLVINNGVNPLSALTGLDTRSLTHHPEFRKIVHGMMAETVAASKADDVNL
GPEDLAEMFDLISNFNAIKTSMLVDKEKGRPLELDSIAGAVLRRCERLGIEAPYTRTVSA
LLTHSQS