Protein Info for Psest_0411 in Pseudomonas stutzeri RCH2

Annotation: biotin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00433: biotin synthase" amino acids 20 to 316 (297 residues), 410 bits, see alignment E=2.9e-127 PF04055: Radical_SAM" amino acids 55 to 210 (156 residues), 74.2 bits, see alignment E=1.5e-24 PF06968: BATS" amino acids 226 to 316 (91 residues), 102.8 bits, see alignment E=9.4e-34

Best Hits

Swiss-Prot: 98% identical to BIOB_PSEU5: Biotin synthase (bioB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 98% identity to psa:PST_3866)

MetaCyc: 74% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGZ1 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Psest_0411 biotin synthetase (Pseudomonas stutzeri RCH2)
MSATSASVTRHDWTLAEVKALFEQPFNDLLFQAQTVHRQHFDANRVQVSTLLSIKTGACP
EDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVL
KMVEGVKAMGLETCMTLGKLDQEQTKALAAAGLDYYNHNLDTSPEYYGNIITTRTYGERL
ETLSYVREAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAE
EQDVDPFDFIRMLAVARIMMPKSHVRLSAGREQMNEQMQALAFFAGANSIFYGEKLLTTA
NPQADKDMQLFARLGIKPEERHEHADEVHQAAIEQALIEQRDSKLFYNAAV