Protein Info for PGA1_c00410 in Phaeobacter inhibens DSM 17395

Annotation: 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase MhpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF01494: FAD_binding_3" amino acids 56 to 393 (338 residues), 205.5 bits, see alignment E=3.5e-64 PF01266: DAO" amino acids 57 to 93 (37 residues), 29.8 bits, see alignment 1.2e-10 PF00890: FAD_binding_2" amino acids 57 to 89 (33 residues), 21.1 bits, see alignment (E = 4.1e-08) PF13450: NAD_binding_8" amino acids 59 to 90 (32 residues), 22.5 bits, see alignment (E = 2.8e-08) PF21274: Rng_hyd_C" amino acids 463 to 563 (101 residues), 27.8 bits, see alignment E=6.3e-10

Best Hits

KEGG orthology group: K05712, 3-(3-hydroxy-phenyl)propionate hydroxylase [EC: 1.14.13.-] (inferred from 84% identity to sil:SPO0682)

Predicted SEED Role

"Monooxygenase family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWI1 at UniProt or InterPro

Protein Sequence (568 amino acids)

>PGA1_c00410 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase MhpA (Phaeobacter inhibens DSM 17395)
MTGSYPIPAAPAGTWESFALRHVFSGGNQMNKIFEVPMYPYQRSEDQDTGAPVRHPVIVI
GAGPVGLSAAIDLAQQGIGVVVLDENDKVSFGSRAICFSKRSLEIADRLGFCDPLVDKGV
QWNLGKVFFDDRKVYEFNLLPESGHAQPAFINLQQYYFEEYLVQRAKALQTAGAPIEIRG
RNKVSAIGTHEDHVTLEIDTPEGSYNLEADWLIACDGAGSPTRQMLGLDFVGRVFEDNFL
IADVIMDADFPTERWFWFDPPFNKGQSALLHKQPDGVWRIDLQLGWDIDKEREKRPENVI
PRLKEMLGEDVKFELEWVSIYTFQCRRMEKFRHGRVLFAGDAAHQVSPFGARGANSGLQD
TDNLCWKLKLVLEGKAPESLLDSYDRERVHGADENILNSSRSTDFITPKSEMSRVLRDAV
LDLSEHHAFARPLVNSGRLSLPCTYEGSALNSADALRGPHRTRPGSPCPDAPTSDGYLLP
QLADRFTLLTIDAEAPDSFEEAGITVTRLNLSTKDDKTRTLRERYLGDETSAVYLIRPDQ
HVAARRPAFDENQFRAALRRAIGKETSV