Protein Info for PGA1_c00410 in Phaeobacter inhibens DSM 17395

Annotation: 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase MhpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 56 to 393 (338 residues), 205.5 bits, E=3.6e-64
• PF00890: FAD_binding_2
  • amino acids 57 to 89 (33 residues), 21.1 bits, see alignment (E = 4.1e-08)
• PF01266: DAO
  • amino acids 57 to 93 (37 residues), 29.8 bits, 1.2e-10
• PF21274: Rng_hyd_C
  • amino acids 463 to 563 (101 residues), 28.8 bits, E=3.2e-10

Best Hits

KEGG orthology group: K05712, 3-(3-hydroxy-phenyl)propionate hydroxylase [EC: 1.14.13.-] (inferred from 84% identity to sil:SPO0682)

Predicted SEED Role

"Monooxygenase family protein"

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

See I7DWI1 at UniProt or InterPro

Protein Sequence (568 amino acids)

>PGA1_c00410 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase MhpA (Phaeobacter inhibens DSM 17395)
MTGSYPIPAAPAGTWESFALRHVFSGGNQMNKIFEVPMYPYQRSEDQDTGAPVRHPVIVI
GAGPVGLSAAIDLAQQGIGVVVLDENDKVSFGSRAICFSKRSLEIADRLGFCDPLVDKGV
QWNLGKVFFDDRKVYEFNLLPESGHAQPAFINLQQYYFEEYLVQRAKALQTAGAPIEIRG
RNKVSAIGTHEDHVTLEIDTPEGSYNLEADWLIACDGAGSPTRQMLGLDFVGRVFEDNFL
IADVIMDADFPTERWFWFDPPFNKGQSALLHKQPDGVWRIDLQLGWDIDKEREKRPENVI
PRLKEMLGEDVKFELEWVSIYTFQCRRMEKFRHGRVLFAGDAAHQVSPFGARGANSGLQD
TDNLCWKLKLVLEGKAPESLLDSYDRERVHGADENILNSSRSTDFITPKSEMSRVLRDAV
LDLSEHHAFARPLVNSGRLSLPCTYEGSALNSADALRGPHRTRPGSPCPDAPTSDGYLLP
QLADRFTLLTIDAEAPDSFEEAGITVTRLNLSTKDDKTRTLRERYLGDETSAVYLIRPDQ
HVAARRPAFDENQFRAALRRAIGKETSV