Protein Info for Psest_4171 in Pseudomonas stutzeri RCH2

Annotation: Flagellar motor switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF14842: FliG_N" amino acids 30 to 125 (96 residues), 74.6 bits, see alignment E=1.8e-24 PF14841: FliG_M" amino acids 139 to 213 (75 residues), 70.1 bits, see alignment E=3.1e-23 PF01706: FliG_C" amino acids 241 to 345 (105 residues), 90.9 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 86% identity to pmk:MDS_4746)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRL2 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Psest_4171 Flagellar motor switch protein (Pseudomonas stutzeri RCH2)
MKEISTQPAEESQASSREIKPRPVQLRSVSSLDQAAILMLSMGDEISAGILRNFSREEII
SISQAMARLSNVKQPMVSDVISRFFDDYKEQSSIKGASRSYLAGMLGKALGGDITRSLLD
SIYGEEIRAKMAKMEWLDPKQFAALIAKEHAQMQAVFLAFLPPGMATEVLECMPAERQDE
LLYRIANLSEVNSDVIAELEQLIDRSLKVLSTQGSQVRGVKQAADIMNRFKGNRDQMFEL
LRAHNEELVGKIEDEMYDFFILSRQNQDVLQTLLEVIPLDEWVVALKGAEPELVKAIQGA
MPKRQAQQMESINRRQGPVPLSRVEQVRKDIMAVVREMSADGELQVQLFREQTVE