Protein Info for Psest_4164 in Pseudomonas stutzeri RCH2

Annotation: flagellar biosynthetic protein FliS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00208: flagellar protein FliS" amino acids 8 to 124 (117 residues), 71.8 bits, see alignment E=2.9e-24 PF02561: FliS" amino acids 10 to 126 (117 residues), 109.6 bits, see alignment E=5.7e-36

Best Hits

Swiss-Prot: 32% identical to FLISA_PSEAI: Flagellar secretion chaperone FliSA (fliS) from Pseudomonas aeruginosa

KEGG orthology group: K02422, flagellar protein FliS (inferred from 85% identity to pmk:MDS_0201)

Predicted SEED Role

"Flagellar biosynthesis protein FliS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U3GKG8 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Psest_4164 flagellar biosynthetic protein FliS (Pseudomonas stutzeri RCH2)
MTYLPNDSYDSYRSVDLEARAASASPYELVLVLMDGLLDELARARGHIEHKRYQQKGASL
EKCMNILNGLNGALDEEGGGEVVQGLARLYEYCIYRLSDVSVTLSLEGLDEVVNLLGTLR
EGWEGVSAARK