Protein Info for HP15_4031 in Marinobacter adhaerens HP15

Annotation: catechol 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR03211: catechol 2,3 dioxygenase" amino acids 4 to 307 (304 residues), 448.6 bits, see alignment E=5.5e-139 PF00903: Glyoxalase" amino acids 8 to 119 (112 residues), 33.8 bits, see alignment E=2e-12 amino acids 150 to 266 (117 residues), 64.9 bits, see alignment E=4.5e-22

Best Hits

Swiss-Prot: 82% identical to XYLE1_PSEPU: Metapyrocatechase (xylE) from Pseudomonas putida

KEGG orthology group: K00446, catechol 2,3-dioxygenase [EC: 1.13.11.2] (inferred from 76% identity to avn:Avin_08720)

MetaCyc: 82% identical to subunit of catechol 2,3-dioxygenase (Pseudomonas putida mt-2)
Catechol 2,3-dioxygenase. [EC: 1.13.11.2]

Predicted SEED Role

"Catechol 2,3-dioxygenase (EC 1.13.11.2)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.2

Use Curated BLAST to search for 1.13.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKX3 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HP15_4031 catechol 2,3-dioxygenase (Marinobacter adhaerens HP15)
MKKGVMRPGHVQIRVLDMDEALKHYTDLLGLIETDRDDHGRVYLKAWTEVDKFSVVLRPA
DEPGMDFMAFKVVDEASLQQLEKDLADHGVEVEQVPEGELKDCGRRVRFNAPSGHTFELY
ADKKYTGKWGITEVNPEAWPRGLDGMKAVRFDHCLLYGPELAATYDLFVNVLGFYLAEQV
LDGDGTRIAQFLTLSTKAHDIAFIHHEEKGKFHHASFYLETWEDVLRAADLISMTDTSID
IGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWQAEQLGKAIFYHDRVLNE
RFLTVLT