Protein Info for Psest_4159 in Pseudomonas stutzeri RCH2

Annotation: flagellar motor stator protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 372.7 bits, see alignment E=5e-116 PF20560: MotA_N" amino acids 5 to 90 (86 residues), 93.2 bits, see alignment E=9.9e-31 PF01618: MotA_ExbB" amino acids 127 to 239 (113 residues), 48 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 88% identity to pmy:Pmen_0192)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTL1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psest_4159 flagellar motor stator protein MotA (Pseudomonas stutzeri RCH2)
MQKVLGAFIIIGCVLGGYAMANGDMRVLWQPAEIVIILGAAIGSLVVGNPKEVLVEMLSQ
IRGVFIYERRGEEFQRQLLMLLYELLEMVDVGGLKVLDSHIEEPEQSELFARYPLILKEK
NLMAFIADNFRLMAMGKISAHELEGFLEQELEAMEHALLQPSRSLFKIGEAMPGFGILAA
IMGIIITMGSIGGSVAEIGAHVAAALVGTFLGIFFCYCLMEPLSNAMGQRVKTELSALEC
VRTTLVAHLAGKPTLLAVDAGRKLIEQDVKPAFRQLEVWVNQYEEERDAA