Protein Info for Psest_4154 in Pseudomonas stutzeri RCH2

Annotation: flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 125 to 259 (135 residues), 129.2 bits, see alignment E=5.1e-42 PF13144: ChapFlgA" amino acids 138 to 258 (121 residues), 115.8 bits, see alignment E=1.3e-37 PF08666: SAF" amino acids 146 to 198 (53 residues), 31.7 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 53% identity to pmy:Pmen_0205)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTK6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psest_4154 flagella basal body P-ring formation protein FlgA (Pseudomonas stutzeri RCH2)
MNKSAKHRPRFNTLLPHRAQREDRSGKRTSAWAALLLLPGLVWAQGGADEQIRQAVDRHL
NDALLREAKRQGWQGARLSHDTSLPASTARLPRCAHPLQVRDASGSESLLDRQRLTISCP
DANGWTLDINSQPSVWLPAVHAQGIIERGQTLGRDDLKLEPINIGKAQRGYFNRLEEVQG
MAAKRRIRAGQTLTPSLLAQPLAVKRGQPVRIVASHDGIEASTSGEALADGQPGEVIRVR
NVRSGKVIDAKVVEEGVVTSTF