Protein Info for Psest_4151 in Pseudomonas stutzeri RCH2

Annotation: Flagellar hook capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF03963: FlgD" amino acids 20 to 76 (57 residues), 49.9 bits, see alignment E=4.6e-17 PF13861: FLgD_tudor" amino acids 89 to 213 (125 residues), 34 bits, see alignment E=4e-12 PF13860: FlgD_ig" amino acids 110 to 177 (68 residues), 38.4 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 66% identity to pmk:MDS_0222)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRJ2 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Psest_4151 Flagellar hook capping protein (Pseudomonas stutzeri RCH2)
MSSVNSALDASLAGNSIDQVKRAVNVSDATTMENNFISLMVAQIKYQDPTKPVDSTEFLN
QFSAMSQVKSMENMTSLAQNNLVLMDNLQTLTAAGLVGQQVRVAVDSLQLGTQPLQGQFT
LAHASNRTAVVLTDSNGLKTTVELGARAPGQVPFDIDPQRLGLPAGQYSVVIESDNGEFP
QVEVAGLVGNVRVSAEGPVLQIDGVGSVPFYNILEFGAGRA