Protein Info for Psest_4148 in Pseudomonas stutzeri RCH2

Annotation: flagellar basal-body rod protein FlgG, Gram-negative bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03506: flagellar hook-basal body protein" amino acids 3 to 136 (134 residues), 154 bits, see alignment E=8.8e-49 amino acids 144 to 243 (100 residues), 110 bits, see alignment E=2.1e-35 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 260 (257 residues), 336.9 bits, see alignment E=8.3e-105 PF00460: Flg_bb_rod" amino acids 8 to 35 (28 residues), 37.6 bits, see alignment (E = 2.5e-13) PF22692: LlgE_F_G_D1" amino acids 96 to 159 (64 residues), 80.5 bits, see alignment E=1.2e-26 PF06429: Flg_bbr_C" amino acids 215 to 259 (45 residues), 66.7 bits, see alignment 1.6e-22

Best Hits

Swiss-Prot: 49% identical to FLGG_BUCAP: Flagellar basal-body rod protein FlgG (flgG) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 92% identity to pmk:MDS_0225)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPE5 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Psest_4148 flagellar basal-body rod protein FlgG, Gram-negative bacteria (Pseudomonas stutzeri RCH2)
MNSALWVSKTGLAAQDKAMATVANNLANVNTNGFKSDRAVFEDLFYVIEKQPGAQADEIN
TVPSGIQLGSGVRVAGTQKVFTEGSIQTTGQPMDLAIVGRGFFQVEAPNGDIFYTENGQF
QLNAEGMMVNAQGLPLNPAIEVPEGSTGFTVGSDGIVTAVLAGDTLPSELGQITLVNFTN
PGGLEALGGNLYRETVASGEPVEGVPGEEGLGQLKQGVLEGSNVQVVEAMVAMIAIQRAY
EANAKVLDAASGMQQFLNQTV