Protein Info for HP15_4014 in Marinobacter adhaerens HP15

Annotation: FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 522 to 538 (17 residues), see Phobius details PF01266: DAO" amino acids 36 to 74 (39 residues), 32.2 bits, see alignment 1.7e-11 PF00890: FAD_binding_2" amino acids 36 to 75 (40 residues), 32.2 bits, see alignment 1.5e-11 PF13450: NAD_binding_8" amino acids 39 to 97 (59 residues), 53.6 bits, see alignment 4.5e-18 PF01593: Amino_oxidase" amino acids 44 to 526 (483 residues), 44.7 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K09516, all-trans-retinol 13,14-reductase [EC: 1.3.99.23] (inferred from 85% identity to maq:Maqu_0318)

Predicted SEED Role

"Carotenoid cis-trans isomerase (EC 5.2.-.-)" in subsystem Carotenoids (EC 5.2.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.23 or 5.2.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKV6 at UniProt or InterPro

Protein Sequence (552 amino acids)

>HP15_4014 FAD dependent oxidoreductase (Marinobacter adhaerens HP15)
MVKSTEVNSPSSQKLKPSTIRIGTRYRANRLKGPYDAIVIGSGIGGLTTAACLAKAGKKV
LVLEQHYTAGGYTHSYARNGYEWDVGVHYIGDMGSPHTLGRRLFDYITDGKLEWAPMDEN
YDRFFLGEMVVNLRAGKEGLRLSLLDAFPDEQEAIDQYVKLLGKVADGMQWYTLSKLAPG
ILSPVINKGLDVALPDCFNKTTWEVLSELTNNQELIGAITGQWGDCGVTPMQSSFMVHAL
IAKHYLYGGFYPVGGASEIAKTIIPVIQQPGGEVFTYADVTDILVEKGRATGVRMADGEE
IRAPLVISNAGVINTFEKLLPAESAEKIGYKSKRQHIIPSMPHIGLYIGLKGTPEALGLP
RTNFWIYPSADHDGNVQQFLDDPDNTEFPVVYISFPAAKDPDYQNRWPGTSTIEIVAPTT
WEMFEPWQGTIWGKRGDDYEALKQKITDQLLEVMYEKLPQLRGKVDYVETSTPLSTAWFC
RYGRGELYGLDHNPERFEQEWLKPKTDIPGLYLTGQDILTCGVVGAMIGGLVSTLAIQGL
RGAGLAKRIFVG