Protein Info for Psest_4145 in Pseudomonas stutzeri RCH2

Annotation: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF10135: Rod-binding" amino acids 45 to 95 (51 residues), 42.2 bits, see alignment 9.5e-15 PF01464: SLT" amino acids 146 to 246 (101 residues), 88.7 bits, see alignment E=2.1e-29

Best Hits

KEGG orthology group: None (inferred from 66% identity to pmk:MDS_0228)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTA3 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_4145 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) (Pseudomonas stutzeri RCH2)
MSIVSLPQHLNAMRARHDGPSAARRQQLEMVSEQFEAMFLQQILKQMRKAGDVLSAGNPM
RSRELDTMRDFYDEVLAETLAGKRQTGIADMLVQQLSGGLDGTAPAPAALGLASAGQGGQ
HALRGTWQRGVDALDNAWAAGKAGFRALVDSVIKQESSGNVAAVSPKGARGLMQLMPGTA
RDMAAELGLPFDEARLTSDAEYNKRLGSAYLNKMLERYDGHQALALAAYNAGPGKVDEWL
KNHGDPRRGEIDAASWIHKIPYQETRDYTRNILKDLQAANSQPREPQAAVQSSGWPQAAQ
ASLATAERLSRGQLLAVVEGKRIAEQQPASAAFNSAPAAVALDRQQPVAARHLSVAFAQP
IRIDSKEALS