Protein Info for Psest_4131 in Pseudomonas stutzeri RCH2

Updated annotation (from data): alpha-ketoglutarate sensor protein (mifS)
Rationale: Specific phenotype on a-ketoglutarate and 56% identical to PA5512 (mifS), which regulates a-ketoglutarate transport in P. aeruginosa (PMC4482717). The transporter in this organism is Psest_0084:0085.
Original annotation: Signal transduction histidine kinase regulating C4-dicarboxylate transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 302 to 321 (20 residues), see Phobius details PF02743: dCache_1" amino acids 42 to 224 (183 residues), 48 bits, see alignment E=1.8e-16 PF00512: HisKA" amino acids 364 to 428 (65 residues), 31.4 bits, see alignment E=2.5e-11 PF02518: HATPase_c" amino acids 473 to 578 (106 residues), 78.5 bits, see alignment E=7.7e-26

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 92% identity to psa:PST_0153)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRH7 at UniProt or InterPro

Protein Sequence (587 amino acids)

>Psest_4131 alpha-ketoglutarate sensor protein (mifS) (Pseudomonas stutzeri RCH2)
MPALPNRLRVTLIVALILVGLLLSMHWAGRLAEQRAWAERSQESQGQLELYAQAIHTQVE
RFRSVPALLALDSDIQGLLADPGNRALRRELNQRLEQQNHAAGSSVLYLLDRNGETIAAS
NWRDWSSFVGNNYAFRPYFRDAVAHDSGRYFAVGVTTGIPGYFLSSSVKSATGEVLGVLV
VKLELEDMQRDWVGQPGILLIADSLDIVILTNRPAWRFRYLRPLSDEVRSRLIDVRRYAE
QTLQPLQSSRVQQLSESSERRLVDGPDGRREYLWQRLALPEEDWTLHLLHDPQMVVASVR
SYRLAAAGVWMTLAFLLLYLAQRRKTRRVEMRSRSELEHLVHERTRELHTAQDELVHAAR
MAALGQMSAALAHEINQPLTALRMQLASLRLLLDSGRDGEVREGLGHVEGLLERMAALTG
HLKTFARKSPAGLRQRLSLAEVLEQALQLLSPRIRSEQVEVFRQVPAEAMVSGDAIRLEQ
VLINLLHNALDAMAGRPQRRLRILCQLNGDSWQLSVGDNGGGIASEHLDQVFEPFFTTKP
VGQGLGLGLAVSYGIVRDMGGTLEVSNDAHGAVFTLTLLAVEGHAAE