Protein Info for HP15_3998 in Marinobacter adhaerens HP15

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 32 to 335 (304 residues), 229.9 bits, see alignment E=1.9e-72 PF25876: HH_MFP_RND" amino acids 94 to 163 (70 residues), 49 bits, see alignment E=1.8e-16 PF25954: Beta-barrel_RND_2" amino acids 201 to 270 (70 residues), 37.4 bits, see alignment E=7.4e-13 PF25967: RND-MFP_C" amino acids 292 to 333 (42 residues), 27.9 bits, see alignment 5.7e-10

Best Hits

KEGG orthology group: None (inferred from 56% identity to din:Selin_1267)

Predicted SEED Role

"AcrA/AcrE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKU0 at UniProt or InterPro

Protein Sequence (355 amino acids)

>HP15_3998 secretion protein HlyD (Marinobacter adhaerens HP15)
MGRLVAAGVMVSLALLSAMAQAQSSERALMSEAVERSMLQETVHLDGVIEAVQQSTVSAQ
TSGIVRSLPFDVDDSVAAGDLIVQLEDSEQRSRLRQAEAGLEEAEAALADAGQRFERIEA
VHERGLVSRQEFDQARNNLAAARARVERARASVSEAQEQLSYTRVLAPYGGILTERHVEV
GEAVNPGQPLLSGLSLEQLRVVVDLPQKYAELARMERQAQVTLADGRVMETGEMTFYPYA
DPQTHTFRLRMRLSEPNGSLFPGMLVKVSVPVASRETLWVPFSSLIQRSELRAVFVLDDQ
DQPRLRQVRTGVRDNGRLEILAGLSEGERVVTNPSVLVGSERLNPLERTGEESSP