Protein Info for Psest_4129 in Pseudomonas stutzeri RCH2

Annotation: Sulfate permease and related transporters (MFS superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 44 to 80 (37 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 352 to 382 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 143 (130 residues), 98.5 bits, see alignment E=5.6e-32 amino acids 140 to 350 (211 residues), 112.8 bits, see alignment E=2.5e-36 PF16983: MFS_MOT1" amino acids 235 to 331 (97 residues), 31.3 bits, see alignment E=3.6e-11 PF01740: STAS" amino acids 401 to 486 (86 residues), 44.1 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_0154)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTI3 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Psest_4129 Sulfate permease and related transporters (MFS superfamily) (Pseudomonas stutzeri RCH2)
MLQSIKQNWFSNIRGDVLSGLVVALALIPEAIAFSIIAGVDPRVGLYASFCIAVVIAFVG
GRPGMISAATGAMALLMVTLVREHGLQYLLAATLLCGLLQIGAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYLFPYVPKLGKVIPSPLVCILSM
TAVAVYFGLDIRTVADMGDLPDTLPVFLWPEVPLTFETLAIIFPYSAALAVVGLLESLMT
ATIVDDLTDTSSDKNRECKGQGVSNIVSGLFGGMAGCAMIGQSVINVKSGGRTRLSTLIA
GVVLLLMVVFLSDWVGQIPMAALVAVMIMVSIGTFSWDSLRNLKRYPLSTNIVMVVTVVV
VVFTHNLAYGVLAGVLLAAMFFANKVGHYLHIGSELDATGNQRTYKVIGQVFFSSSDKFT
GAFDFKEALGKVTIDLSRAHFWDITAVAALDKVVIKFRREGTEVEVLGLNEASATIVDRF
GVHDKPEAIDKLMSH