Protein Info for Psest_4127 in Pseudomonas stutzeri RCH2

Annotation: Cyclopropane fatty acid synthase and related methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF25371: DUF7884" amino acids 13 to 75 (63 residues), 33.1 bits, see alignment E=2.5e-11 PF02353: CMAS" amino acids 97 to 371 (275 residues), 366.6 bits, see alignment E=3.7e-113 PF13489: Methyltransf_23" amino acids 145 to 312 (168 residues), 47.9 bits, see alignment E=5.9e-16 PF01728: FtsJ" amino acids 146 to 202 (57 residues), 26.8 bits, see alignment E=2.1e-09 PF05175: MTS" amino acids 150 to 235 (86 residues), 26.5 bits, see alignment E=2e-09 PF13847: Methyltransf_31" amino acids 157 to 261 (105 residues), 45.8 bits, see alignment E=2.6e-15 PF08241: Methyltransf_11" amino acids 163 to 260 (98 residues), 57.6 bits, see alignment E=7.2e-19 PF08242: Methyltransf_12" amino acids 163 to 259 (97 residues), 47.3 bits, see alignment E=1.3e-15 PF13649: Methyltransf_25" amino acids 163 to 258 (96 residues), 72.6 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 68% identical to FAMT_PSEPU: Probable fatty acid methyltransferase from Pseudomonas putida

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 86% identity to psa:PST_0156)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS27 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Psest_4127 Cyclopropane fatty acid synthase and related methyltransferases (Pseudomonas stutzeri RCH2)
MLATLLPALKELALPLKLQLWDGKEIDIGPAPCVTLVIKDPNLVTRLAQPSLVVFGAAYV
EGQIDLLGPVHEVIRIGDVITRALGEDDFPLPSREAHDKTTDAEAISYHYDLSNDFYRLW
LDKDMVYSCAYFETGSEDLEQAQQAKLRHLCRKLRLKPGERLLDVGCGWGGLARYAAREF
GAKVFGITLSREQLELARERVAAEGLQKQITLELMDYRDLPQDGRFDKVVSVGMFEHVGH
ANLSLYCQRLFDAVRPGGLVMNHGITARHIDGRPVGHGAGEFIDRYVFPHGELPHLVNIS
SCISEAGLEIVDVESLRLHYARTLDFWSERLEAQLEQAKQMVPERALRIWRLYLAGCAYG
FRHNWINLHQILASKPLADGSHELPWSRADLYS