Protein Info for PGA1_c04160 in Phaeobacter inhibens DSM 17395

Annotation: putative crotonobetaine/carnitine-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 193 to 217 (25 residues), see Phobius details PF00501: AMP-binding" amino acids 9 to 359 (351 residues), 252.3 bits, see alignment E=7.4e-79 PF13193: AMP-binding_C" amino acids 410 to 484 (75 residues), 47 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: K01913, [EC: 6.2.1.-] (inferred from 45% identity to reh:H16_B0677)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWF5 at UniProt or InterPro

Protein Sequence (501 amino acids)

>PGA1_c04160 putative crotonobetaine/carnitine-CoA ligase (Phaeobacter inhibens DSM 17395)
MTLWHEYIEQHARQRPKAPAFGDSGGARWTYGDLARACNALMTHLADLGVGPGDRVMLLC
ENCCAAVAALFATSQLGAVAVPVNARMRAPEVDRILAHAQPAAVLLTAAASPDAAAHASR
LGAQRVEGDFGCLHVVSQDAGGKSCAQIPEGLAVLLYTTGTTGAPKGVMLSHDNLKFGGG
ASARLRDMASEDVVYGVLPLSHVFGLASVLTASVMIGAEVRLETRFTAERFYQALRSGVT
LVSGVPQMHALVMQYAKEQGLDHLGSPDLRYVSSGAAPLDPDWKRRAEAFYGVALQNGYG
MTEATAGICATRNGLGDPDTSVGPPLPGVELRLDQSVPGGGDGLGEICLRGGNVMLGYFA
NQEATQTVLDPAGWLRSGDIGRLDESGNLHIDGRAKELIIHGGFNVFPPEVEAALNAHPQ
VVQSAVVGRPQGGDEQVVAFVEVAVGDEPKVSELRAFVAEQLAGYKRPGLFILTEQLPAA
PTGKILKHVLLSHFADQLPAV