Protein Info for HP15_3989 in Marinobacter adhaerens HP15

Annotation: F0F1 ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR01039: ATP synthase F1, beta subunit" amino acids 15 to 462 (448 residues), 586.9 bits, see alignment E=1.5e-180 PF02874: ATP-synt_ab_N" amino acids 18 to 80 (63 residues), 25.1 bits, see alignment E=3e-09 PF00006: ATP-synt_ab" amino acids 137 to 350 (214 residues), 244.4 bits, see alignment E=1.5e-76 PF22919: ATP-synt_VA_C" amino acids 357 to 426 (70 residues), 45 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 80% identical to ATPB2_NITEC: ATP synthase subunit beta 2 (atpD2) from Nitrosomonas eutropha (strain DSM 101675 / C91)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 80% identity to net:Neut_2013)

MetaCyc: 54% identical to ATP synthase F1, beta subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKT1 at UniProt or InterPro

Protein Sequence (463 amino acids)

>HP15_3989 F0F1 ATP synthase subunit beta (Marinobacter adhaerens HP15)
MSHNESLDTLQDAGKGTVVAIRGGVVSVRFPEPVPQIRELLYAGKIALEVAALEDRGVVR
CMALAPVKGLGLGMPVRATGSPITVPVGDAILGRMLNVFGAPVDNQPVPATSERRAIHQL
PPLLEDRVVRSQILETGIKAIDLLSPIERGGKTGLFGGAGVGKTVLITELINNTVQQHKG
VSLFCGIGERSREAEELYREMGEAGVLENTVMLFGQMNEVPGVRFLIGKTALTMAEYFRD
EQHRDVLLLIDNIFRFVQAGSEVSGLLGRMPSRVGYQPTLATELAELEERITSTHSAAIT
SVQAVYVPADDFTDPAAAHIFSHLSGSVVLSRKRASEGLYPAIDPLASSSVMLTPSVVGQ
RHYDIARAVRRTLAEYEELRDIIAMLGIEELSAADRTTVARARRLERFLTQPFFTTAAFT
GAEGKRVTIAETLDGCEAILEQTEFDRDESEYYMIGALPEVVA