Protein Info for HP15_3986 in Marinobacter adhaerens HP15

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF02274: ADI" amino acids 36 to 406 (371 residues), 389.6 bits, see alignment E=8.1e-121

Best Hits

Swiss-Prot: 84% identical to ARCA_TOLAT: Arginine deiminase (arcA) from Tolumonas auensis (strain DSM 9187 / TA4)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 84% identity to tau:Tola_2459)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKS8 at UniProt or InterPro

Protein Sequence (409 amino acids)

>HP15_3986 arginine deiminase (Marinobacter adhaerens HP15)
MSEQTLGVHSETGTLRQVIICRPGLAHRRLTPSNCDALLFDDVFWVKQAQKDHDVFASVM
RGRGVEVLDVNELLAETLAIPEGRAWILDHRINWNHIGVGMVSDLRAWMDELPEKALAEF
LIGGLEVGDLPFDPVGLFGNHLGRFGFVLPPLPNFLFTRDNSAWVYGGVTLNPMYWVARK
PETLLMAAIYRFHPKFAGKVNVHWGDPLEDHGLATLEGGDIMPLGNRTVLVGMGERSSPQ
AIGQLSKALFDGGMVDRVIACQLPKTRSAMHLDTVFTFCGGNVVTAFKEVADAVICYDLR
PGEGAKTLAFNQDSRHLFEVVAEILGYPALEVVPTGGDTPEEREREQWNDGNNVLALSPG
VVVGYDRNDDTNAALSAAGIEVLAIPGAELGRGRGGGRCMSCPTIRDAI